Daniel
Gold Level Expert
Positive Feedback: 92.7%
Accepted Answers: 2174
Daniel is a certified expert with Answeroom. Daniel has achieved 'Gold' level status, the highest overall rating possible. Daniel has a satisfaction rating of 92.7%
Live chat
Daniel: Hi, my name is Daniel.
Daniel: Can I help you with your questions?
 
Are you an AnsweRoom returning user?
Sign In
Register
Search
Welcome to AnsweRoom Q&A, where you can ask questions and receive answers from other members of the community.
long check cost number letter write school tv pch refund find university pay call win mobile india visa start house tax activate model card phone online credit week send money code time inch entry led philippines prize year everest search working application carry help bank square build day status dubai


How do i activate my entry for #1830 to win $5,000.00 forever?

i need help to activate my entry on pch.com to win $5,000.00 a week foever,can you help me to learn to activate my entry, every time i try it ends up bringing me to another page or right back where i started, thank you
asked 1 year ago by cbsbreaux54 (200 points) 1 flag
Add your answer below and help build our online community of people helping people. Meet new people and make new friends with common interests. Share your knowledge and learn.

Trying to check your email

8 Answers

1 like 1 dislike
Yes. I have trried at least a dozen times.
answered 1 year ago by jaimary (120 points)
0 like 0 dislike
Follow PCH's instructions precisely.
answered 7 months ago by jcommsal (160 points)
0 like 0 dislike
Help with activating my forever million entry for #1830
answered 7 months ago by yrredden (0 points)
0 like 0 dislike
By registering
answered 2 months ago by FHM (110 points)
0 like 0 dislike
I would like to know using activate a PCH entry to win the $5,000.
answered 4 weeks ago by mlstaskiews (140 points)
0 like 0 dislike
yes i want 5.000.00 for life 3x4x5x activate entry
answered 2 weeks ago by anonymous
0 like 0 dislike
How do I activate  ch $5,000.00 forever prize?
answered 1 week ago by anonymous
0 like 1 dislike
i HAVE BEEN TRYING SINCE 1972. SHOW ME WHAT i CANDO TO WIN.
answered 1 year ago by anonymous

Related answers

2,737 views
Ido have a gold membership Its is a scratchcard I am supposed to be looking for Some how my sons email address got logged into my compeuter because of his xbox anf wiped out my entries I have been w()
3,870 views
I wishtotowin 214 itwoodbegrestibeplayfor4yearhavenotwininmylifeifiwiniwelltaketdinnerandgoonatripeihopetoseepeoplesinmylifetimegodblessjohnwilbert
2,540 views
1,625 views
i waiting at the door for it to be knocked on my pchthe drive way is clear and plenty of room to parkhurry times a wasting see you soon

Your answer

Email me at this address if my answer is selected or commented on:
Privacy: Your email address will only be used for sending these notifications.
Anti-spam verification:
To avoid this verification in future, please log in or register.

Related discussions

I am trying to activate entry #308?

i have been trying to activate entry for several days for ''FOREVER'' Dream home., the sweepsteaks that offers $5,000.00 a week for life. I have tried everything but have not found an answer to my problem. I would be very thankful if you can help me with my problem.
Comment
Pls Activate my entry for pch superprize eligibility to Win $7,000.00 A Week For Life gwy no. 3080, & pch unclaimed prizes gwy 4228A for April 30th. ..pls pls I wanna Win, thnx Pauline...

How do i activate my entry for 1830 to win 500000 forever?

how do i activate my entry for 1830 to win 500000 forever
Comment
how do I activate my entry for 1830 to win $ 500,000.00 forever.

How do i activate pch entry $5,000.00 a week forever on august 29th??

what do i have to do to activate my final entry to win $5,000.00 a week forever, i've tried everything an no success
Comment

How do I activate PCH ENTRY 500000 A WEEK FOREVER On August 29th?

How do I activate PCH ENTRY 500000 A WEEK FOREVER On August 29th
Comment

How do I activate entry for $5,000.00 a week forever??

I can not find an answer for how to do it. activate entry for $5,000.00 a week forever
Comment

Where do I find the right place to activate my 5,000.00 a week forever entry??

I've been searching and I can not find where to activate this entry. Please help me with this find this prize entry activation for PCH.
Comment

How do I activate my entry to win $5,000.00 A Week "FOREVER" for PCH GWY. NO. 1830 for August 29th 2013?

don't know how to activate entry for PCH GWY. NO. 1830, I need to find out how to activate the Giveaway for Number 1830.
Comment

Activate prize entry #34 08 for forever prize on august 29th from pch?

prize alert #34 08 continue activation sequence search to secure actavation i need secure pak for the forever prize entry #34 08 fo win $5000.00 a week forever prize on august 29th
Comment

Post A Comment

Related questions

Alternate wordings
I dont have a question I just want to win? How Many Times Do I Need To Search Pch For Issuance Dispatch And Activation? How do I find out my chances of winning the forever prize 3080? HOW DO I ACTIVATE ENTRY ? DID CLICKING HERE DO IT? can i activate my entries to win 5 000 a week forever? How do I claim and activate my depoist for 500000 a week for Life Forever No3080? How do I confirm my entry number for Forever Entry for PCH? how to win 100000000 a year forever? is this my entry towin forever? I want to claim my number for entry in $5,000.00 a week forever? how to active my pch entry for $10,000,000.00? How do I activate my 50 000 forever entry? how do i finally entry number for #3080? I NEED to ACTIVATE MY ENTRY PCH? how to activate entry today for 1830 giveway at pch?