Daniel
Gold Level Expert
Positive Feedback: 92.7%
Accepted Answers: 2174
Daniel is a certified expert with Answeroom. Daniel has achieved 'Gold' level status, the highest overall rating possible. Daniel has a satisfaction rating of 92.7%
Live chat
Daniel: Hi, my name is Daniel.
Daniel: Can I help you with your questions?
 
Are you an AnsweRoom returning user?
Sign In
Register
Search
Welcome to AnsweRoom Q&A, where you can ask questions and receive answers from other members of the community.
long check cost number letter write school tv find refund win university pay call mobile start visa india house tax card model phone online activate credit week entry send time prize code money inch search led philippines pch year everest working help application carry square claim bank day build


How do i activate my entry for #1830 to win $5,000.00 forever?

i need help to activate my entry on pch.com to win $5,000.00 a week foever,can you help me to learn to activate my entry, every time i try it ends up bringing me to another page or right back where i started, thank you
asked 1 year ago by cbsbreaux54 (200 points) 1 flag
Add your answer below and help build our online community of people helping people. Meet new people and make new friends with common interests. Share your knowledge and learn.

Trying to check your email

8 Answers

1 like 1 dislike
Yes. I have trried at least a dozen times.
answered 1 year ago by jaimary (120 points)
0 like 0 dislike
Follow PCH's instructions precisely.
answered 11 months ago by jcommsal (160 points)
0 like 0 dislike
Help with activating my forever million entry for #1830
answered 10 months ago by yrredden (0 points)
0 like 0 dislike
By registering
answered 6 months ago by FHM (110 points)
0 like 0 dislike
I would like to know using activate a PCH entry to win the $5,000.
answered 4 months ago by mlstaskiews (140 points)
0 like 0 dislike
yes i want 5.000.00 for life 3x4x5x activate entry
answered 4 months ago by anonymous
0 like 0 dislike
How do I activate  ch $5,000.00 forever prize?
answered 3 months ago by anonymous
0 like 1 dislike
i HAVE BEEN TRYING SINCE 1972. SHOW ME WHAT i CANDO TO WIN.
answered 1 year ago by anonymous

Related answers

3,171 views
Yes activate $5 every week forever!!
4,224 views
I wishtotowin 214 itwoodbegrestibeplayfor4yearhavenotwininmylifeifiwiniwelltaketdinnerandgoonatripeihopetoseepeoplesinmylifetimegodblessjohnwilbert
2,600 views
watch out when they say you winn something it cost a dollar to ship but other catch it you wind up join something costing more

Your answer

Email me at this address if my answer is selected or commented on:
Privacy: Your email address will only be used for sending these notifications.
Anti-spam verification:
To avoid this verification in future, please log in or register.

Related discussions

I am trying to activate entry #308?

i have been trying to activate entry for several days for ''FOREVER'' Dream home., the sweepsteaks that offers $5,000.00 a week for life. I have tried everything but have not found an answer to my problem. I would be very thankful if you can help me with my problem.
Comment
Pls Activate my entry for pch superprize eligibility to Win $7,000.00 A Week For Life gwy no. 3080, & pch unclaimed prizes gwy 4228A for April 30th. ..pls pls I wanna Win, thnx Pauline...

How do i activate my entry for 1830 to win 500000 forever?

how do i activate my entry for 1830 to win 500000 forever
Comment
how do I activate my entry for 1830 to win $ 500,000.00 forever.

How do i activate pch entry $5,000.00 a week forever on august 29th??

what do i have to do to activate my final entry to win $5,000.00 a week forever, i've tried everything an no success
Comment

How do I activate PCH ENTRY 500000 A WEEK FOREVER On August 29th?

How do I activate PCH ENTRY 500000 A WEEK FOREVER On August 29th
Comment

How do I activate entry for $5,000.00 a week forever??

I can not find an answer for how to do it. activate entry for $5,000.00 a week forever
Comment

Where do I find the right place to activate my 5,000.00 a week forever entry??

I've been searching and I can not find where to activate this entry. Please help me with this find this prize entry activation for PCH.
Comment

How do I activate my entry to win $5,000.00 A Week "FOREVER" for PCH GWY. NO. 1830 for August 29th 2013?

don't know how to activate entry for PCH GWY. NO. 1830, I need to find out how to activate the Giveaway for Number 1830.
Comment

Activate prize entry #34 08 for forever prize on august 29th from pch?

prize alert #34 08 continue activation sequence search to secure actavation i need secure pak for the forever prize entry #34 08 fo win $5000.00 a week forever prize on august 29th
Comment

Post A Comment

Related questions

Alternate wordings
how to activate entry today for 1830 giveway at pch? I dont have a question I just want to win? how to active my pch entry for $10,000,000.00? How do I activate my entry for 1 million forever and 5000 a week forever? How do I search to activate entry for the Imminent Winners selection? how do i activate the winning entry for$5,000.00every week for life on August 28th? is this my entry towin forever? how to win 100000000 a year forever? how do i finally entry number for #3080? How Many Times Do I Need To Search Pch For Issuance Dispatch And Activation? wHAT IS THE aCTIVATION nUMBER FOR ENTRY $7,000.00? can i activate my entries to win 5 000 a week forever? How do I confirm my entry number for Forever Entry for PCH? How do I activate my 50 000 forever entry? How do I activate entry for 7000entry?